DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosbeta4R2

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster


Alignment Length:194 Identity:44/194 - (22%)
Similarity:74/194 - (38%) Gaps:26/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SVLGIRYDSGVMLAADTLVSYGSMAR---YQNIERVFKVNKNILLGGSGD---FADIQSIKRNID 117
            ::|||:....||||:||:.:...:..   ...|.|:...|....:|..||   |.|.  |.:|:.
  Fly     5 TILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDF--ISKNLH 67

  Fly   118 QKMIEDQCCDDNIEMKPKSLASWMTRVLYNRRSRMNPLY-IDVVVGGVDNEGTPYLANVDLRGRS 181
            ...|     .....:..||.|.:..:.|.: ..|.|..| :.:::.|.|....|.|..:|..|.:
  Fly    68 LYKI-----SHGYHLSAKSAAHFTRKTLAD-YIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAA 126

  Fly   182 YEDYVVATGFARHLAVPLVR---EKKPKDRDFTAVEASELIRTCMEVLYYR---DTRNISQYTV 239
            ........|:.......:::   ..|....|     |..|::.|:..:..|   :.||...|.|
  Fly   127 QSINHAGHGWGSMFCGSILQRYWNSKLSQED-----AYSLMKKCVLEIQRRLIINQRNFEVYVV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 44/193 (23%)
PRE1 60..232 CDD:223711 40/184 (22%)
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 44/194 (23%)
proteasome_beta_type_2 3..194 CDD:239727 44/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.