DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:224 Identity:50/224 - (22%)
Similarity:88/224 - (39%) Gaps:36/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PVQQLPRELTTMGPYGTKHSTASSTT------GTSVLGIRYDSGVMLAADTLVSYGSMARYQNIE 89
            |..:.|||       ..|...|.|..      ||:.:|..|..|::|..|:..:.|.:...|:|.
  Fly    46 PPYENPRE-------SVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIH 103

  Fly    90 RVFKVNKNILLGGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPK----SLASWMTRVLYNRRS 150
            :|.:||:.|:...:|..||.....|.:.:     :|....:..|.:    |.|.:::.|....:.
  Fly   104 KVVQVNQYIMGTTAGGAADCTYWDRALTR-----ECRLHELRYKERLPVQSAAKYISNVAAEYKG 163

  Fly   151 RMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPL--------VREKKPKD 207
            .  .|.:.:::.|...|| |.|..||..|......:.|.|.....|:.:        :.:.:..|
  Fly   164 M--GLCMGMMLAGWSPEG-PSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYD 225

  Fly   208 RDFTAV---EASELIRTCMEVLYYRDTRN 233
            ..|.||   ..:::....:..||:.|..|
  Fly   226 LAFLAVYHATMTDIFSGGVVRLYHMDQGN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 41/189 (22%)
PRE1 60..232 CDD:223711 40/186 (22%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 50/224 (22%)
proteasome_beta_type_5 72..259 CDD:239730 42/191 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.