DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta7 and Prosbeta2R1

DIOPT Version :9

Sequence 1:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_572267.1 Gene:Prosbeta2R1 / 31511 FlyBaseID:FBgn0029812 Length:307 Species:Drosophila melanogaster


Alignment Length:231 Identity:54/231 - (23%)
Similarity:92/231 - (39%) Gaps:36/231 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 TGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKNILLGGSGDFADIQSI----KRNI 116
            ||||::||.|..||:|.|||..:.|.:...:|..::..:..:|...|:|..||.:.|    ...:
  Fly    47 TGTSIVGIIYKDGVILGADTRATEGPIVSDKNCSKIHHLQDHIYCCGAGTAADTEMITLTTSAEL 111

  Fly   117 DQKMIEDQCCDDNIEMK-PKSLASWM-TRVLYNRRSRMNPLYIDVVVGGVDNEGTPYLANVDLRG 179
            |...:       |.|.: |...||.| .|.|:..:..:...   :|:||||..| |.|..:...|
  Fly   112 DLHRL-------NTERRVPVVCASMMLRRTLFRYQGHIGAA---LVMGGVDTTG-PQLYCIYPCG 165

  Fly   180 RSYEDYVVATGFARHLAVPLVREKKPKDRDFTAVEASELIRTCMEVLYYRDTRNISQYTVGVCSV 244
            .:.:....|.|.....|:.::......|.|..  :..:|:|..:....:.|..:.|  .:.:|.:
  Fly   166 SNDKIPYAAMGSGTLAAMSVLEHGWKPDLDLE--QGKQLVREAISAGVFNDLGSGS--NIDLCVI 226

  Fly   245 NGCGVE---------------GPFQVNENWTFAETI 265
            ...|..               |.:.:..|.|...:|
  Fly   227 TAKGAVYLRTDTIASEKGERLGKYGIKPNSTMVTSI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 46/212 (22%)
PRE1 60..232 CDD:223711 43/177 (24%)
Prosbeta2R1NP_572267.1 20S_bact_beta 48..241 CDD:163402 49/207 (24%)
proteasome_beta_type_7 49..236 CDD:239732 48/201 (24%)
Pr_beta_C 241..274 CDD:289249 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.