DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1161 and TMEM9B

DIOPT Version :9

Sequence 1:NP_649528.2 Gene:CG1161 / 40638 FlyBaseID:FBgn0037313 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_065695.1 Gene:TMEM9B / 56674 HGNCID:1168 Length:198 Species:Homo sapiens


Alignment Length:179 Identity:54/179 - (30%)
Similarity:94/179 - (52%) Gaps:22/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AAPLAKQVSAPTAAPPAKVIGQPVLAAPGKNS----SNSSSTTECVCAGALLPRLDANGKEL-PI 117
            ||...:.|......||.|           :||    :.:.|..:|.|...:.| :...|.:: ..
Human    33 AAKNFEDVRCKCICPPYK-----------ENSGHIYNKNISQKDCDCLHVVEP-MPVRGPDVEAY 85

  Fly   118 CAECKCSHVARNTTLIKVVVIIVIWIISILVIYMLFLMCLDPLLNKRVKANYQEHTNEDDEPTPP 182
            |..|:|.:..|::..|||.:||.:.|:.:|::||::|..::|:|.:|: ..:.:....||:....
Human    86 CLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRL-FGHAQLIQSDDDIGDH 149

  Fly   183 LPAVNNQELSA----RANVLNRVGHQQDKWKRQVREQRRHIYDRHTMLN 227
            .|..|..::.|    ||||||:|.:.|.:||.||:|||:.::|||.:|:
Human   150 QPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1161NP_649528.2 Tmemb_9 97..226 CDD:283167 44/133 (33%)
TMEM9BNP_065695.1 Tmemb_9 57..197 CDD:368441 45/141 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151849
Domainoid 1 1.000 90 1.000 Domainoid score I7784
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I5080
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380345at2759
OrthoFinder 1 1.000 - - FOG0004165
OrthoInspector 1 1.000 - - otm42100
orthoMCL 1 0.900 - - OOG6_105991
Panther 1 1.100 - - O PTHR13064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4828
SonicParanoid 1 1.000 - - X2915
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.