DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1161 and tmem9

DIOPT Version :9

Sequence 1:NP_649528.2 Gene:CG1161 / 40638 FlyBaseID:FBgn0037313 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_956160.2 Gene:tmem9 / 334151 ZFINID:ZDB-GENE-030131-6083 Length:193 Species:Danio rerio


Alignment Length:155 Identity:50/155 - (32%)
Similarity:79/155 - (50%) Gaps:9/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KVIGQPVLAAPGKNSSNSSSTTECVCAGALLPRLDANGKEL-PICAECKCSHVARNTTLIKVVVI 138
            |.|..|.....|.....:.:..:|.|...:.| :...|.:: ..|..|:|.:..|::..|||.:|
Zfish    46 KCICPPYRNITGHIYKKNVTQKDCNCLHVVEP-MPVPGHDVEAYCLLCECKYEERSSNTIKVTII 109

  Fly   139 IVIWIISILVIYMLFLMCLDPLLNKRVKANYQEHTNEDDEPTPPLPAVNNQELSARAN-VLNRVG 202
            |.:.::..|::|||||:.:|||:.|...........||.|...|      :...||.| ||.||.
Zfish   110 IYLSVVGALLLYMLFLLLIDPLIRKHDPYTMPLQNEEDSEDVRP------RVDGARGNTVLERVE 168

  Fly   203 HQQDKWKRQVREQRRHIYDRHTMLN 227
            ..|.:||:||:|||:.::|||.:|:
Zfish   169 GAQQRWKKQVQEQRKTVFDRHKLLS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1161NP_649528.2 Tmemb_9 97..226 CDD:283167 45/130 (35%)
tmem9NP_956160.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586414
Domainoid 1 1.000 90 1.000 Domainoid score I7762
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9515
Inparanoid 1 1.050 95 1.000 Inparanoid score I5049
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380345at2759
OrthoFinder 1 1.000 - - FOG0004165
OrthoInspector 1 1.000 - - otm24258
orthoMCL 1 0.900 - - OOG6_105991
Panther 1 1.100 - - LDO PTHR13064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4828
SonicParanoid 1 1.000 - - X2915
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.