DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1161 and Tmem9b

DIOPT Version :9

Sequence 1:NP_649528.2 Gene:CG1161 / 40638 FlyBaseID:FBgn0037313 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_017444476.1 Gene:Tmem9b / 293415 RGDID:1310775 Length:199 Species:Rattus norvegicus


Alignment Length:158 Identity:51/158 - (32%)
Similarity:89/158 - (56%) Gaps:7/158 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KVIGQPVLAAPGKNSSNSSSTTECVCAGALLPRLDANGKEL-PICAECKCSHVARNTTLIKVVVI 138
            |.|..|....||...:.:.|..:|.|...:.| :...|.:: ..|..|:|.:..|::..|||.:|
  Rat    44 KCICPPYKENPGHIYNKNISQKDCDCLHVVEP-MPVRGPDVEAYCLRCECKYEERSSVTIKVTII 107

  Fly   139 IVIWIISILVIYMLFLMCLDPLLNKRVKANYQEHTNEDDEPTPPLPAVNNQELSA----RANVLN 199
            |.:.|:.:|::||::|..::|:|.:|: ..:.:....||:.....|..|..::.|    ||||||
  Rat   108 IYLSILGLLLLYMVYLTLVEPILKRRL-FGHSQLLQSDDDIGDHQPFANAHDVLARSRSRANVLN 171

  Fly   200 RVGHQQDKWKRQVREQRRHIYDRHTMLN 227
            :|.:.|.:||.||:|||:.::|||.:|:
  Rat   172 KVEYAQQRWKLQVQEQRKSVFDRHVVLS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1161NP_649528.2 Tmemb_9 97..226 CDD:283167 44/133 (33%)
Tmem9bXP_017444476.1 Tmemb_9 58..198 CDD:398868 45/141 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345368
Domainoid 1 1.000 90 1.000 Domainoid score I7602
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I4986
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380345at2759
OrthoFinder 1 1.000 - - FOG0004165
OrthoInspector 1 1.000 - - otm46250
orthoMCL 1 0.900 - - OOG6_105991
Panther 1 1.100 - - O PTHR13064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2915
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.