DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1161 and Tmem9

DIOPT Version :9

Sequence 1:NP_649528.2 Gene:CG1161 / 40638 FlyBaseID:FBgn0037313 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001099423.2 Gene:Tmem9 / 289046 RGDID:1307922 Length:183 Species:Rattus norvegicus


Alignment Length:175 Identity:57/175 - (32%)
Similarity:90/175 - (51%) Gaps:10/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PAAAAPLAKQVSAPTAAPPAKVIGQPVLAAPGKNSSNSSSTTECVCAGALLPRLDANGKEL-PIC 118
            ||.|...::.:......||.:.|.       |...:.:.|..:|.|...:.| :...|.:: ..|
  Rat    17 PAQANKSSEDIRCKCICPPYRNIS-------GHIYNQNVSQKDCNCLHVVEP-MPVPGHDVEAYC 73

  Fly   119 AECKCSHVARNTTLIKVVVIIVIWIISILVIYMLFLMCLDPLLNKRVKANYQEHTNEDDEPTPPL 183
            ..|:|.:..|:||.|||:::|.:.::..|::||.|||.:|||:.|......|.|..|::|....:
  Rat    74 LLCECRYEERSTTTIKVIIVIYLSVVGALLLYMAFLMLVDPLIRKPDAYTEQLHNEEENEDARSM 138

  Fly   184 PAVNNQELSARAN-VLNRVGHQQDKWKRQVREQRRHIYDRHTMLN 227
            .|........||| ||.||...|.:||.||:|||:.::|||.||:
  Rat   139 AAAAASIGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1161NP_649528.2 Tmemb_9 97..226 CDD:283167 47/130 (36%)
Tmem9NP_001099423.2 Tmemb_9 44..182 CDD:398868 48/138 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345369
Domainoid 1 1.000 90 1.000 Domainoid score I7602
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9515
Inparanoid 1 1.050 93 1.000 Inparanoid score I4986
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380345at2759
OrthoFinder 1 1.000 - - FOG0004165
OrthoInspector 1 1.000 - - otm46250
orthoMCL 1 0.900 - - OOG6_105991
Panther 1 1.100 - - LDO PTHR13064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2915
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.