DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1161 and TMEM9

DIOPT Version :9

Sequence 1:NP_649528.2 Gene:CG1161 / 40638 FlyBaseID:FBgn0037313 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001275500.1 Gene:TMEM9 / 252839 HGNCID:18823 Length:208 Species:Homo sapiens


Alignment Length:195 Identity:61/195 - (31%)
Similarity:94/195 - (48%) Gaps:24/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PAAAAPLAKQVSAPTAAPPAKVIGQPVLAAPGKNS--------------------SNSSSTTECV 99
            |.|.|...::||..... ...|.|.||..|..::|                    :.:.|..:|.
Human    16 PPAEANKVREVSLQHLV-TTTVHGHPVYRADSESSEDIRCKCICPPYRNISGHIYNQNVSQKDCN 79

  Fly   100 CAGALLPRLDANGKEL-PICAECKCSHVARNTTLIKVVVIIVIWIISILVIYMLFLMCLDPLLNK 163
            |...:.| :...|.:: ..|..|:|.:..|:||.|||:::|.:.::..|::||.|||.:|||:.|
Human    80 CLHVVEP-MPVPGHDVEAYCLLCECRYEERSTTTIKVIIVIYLSVVGALLLYMAFLMLVDPLIRK 143

  Fly   164 RVKANYQEHTNEDDEPTPPLPAVNNQELSARAN-VLNRVGHQQDKWKRQVREQRRHIYDRHTMLN 227
            ......|.|..|::|....:.|........||| ||.||...|.:||.||:|||:.::|||.||:
Human   144 PDAYTEQLHNEEENEDARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS 208

  Fly   228  227
            Human   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1161NP_649528.2 Tmemb_9 97..226 CDD:283167 47/130 (36%)
TMEM9NP_001275500.1 Tmemb_9 69..207 CDD:398868 48/138 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151850
Domainoid 1 1.000 90 1.000 Domainoid score I7784
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9515
Inparanoid 1 1.050 93 1.000 Inparanoid score I5080
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380345at2759
OrthoFinder 1 1.000 - - FOG0004165
OrthoInspector 1 1.000 - - otm42100
orthoMCL 1 0.900 - - OOG6_105991
Panther 1 1.100 - - LDO PTHR13064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4828
SonicParanoid 1 1.000 - - X2915
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.