DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1161 and R12C12.6

DIOPT Version :9

Sequence 1:NP_649528.2 Gene:CG1161 / 40638 FlyBaseID:FBgn0037313 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001040796.1 Gene:R12C12.6 / 187840 WormBaseID:WBGene00020026 Length:261 Species:Caenorhabditis elegans


Alignment Length:203 Identity:67/203 - (33%)
Similarity:99/203 - (48%) Gaps:56/203 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PVLAAPGKNSSNSSSTTECVCAGALLPRLD--ANGKEL--------------------------- 115
            |.|:..|..::...:...|:|. :||..||  .|..|.                           
 Worm    60 PALSQAGTEANFEDTRCRCICP-SLLKFLDLAENTTEKTEGLRRRFYTKTNIEPSHCKPSNIVKD 123

  Fly   116 ------------PICAECKCSHVARNTTLIKVVVIIVIWIISILVIYMLFLMCLDPLL-NKRVKA 167
                        ...|.|.|.:.:|||.|:|||||.||.:|::|..||:|||||||:| .||:..
 Worm   124 QVSNFVDETHMDAFLANCDCRYESRNTVLLKVVVIFVICVIAVLTGYMVFLMCLDPMLRKKRLSI 188

  Fly   168 NYQEHTNE------------DDEPTPPLPAVNNQELS-ARANVLNRVGHQQDKWKRQVREQRRHI 219
            :||:|.:|            |||.:....:::.|..: ||:|||.||..:|::|.::|.||||:|
 Worm   189 SYQQHNDEMEDNIFAAAPSTDDESSSASNSMDTQGTTRARSNVLGRVEAEQNRWMKKVEEQRRNI 253

  Fly   220 YDRHTMLN 227
            ::.|||||
 Worm   254 FEDHTMLN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1161NP_649528.2 Tmemb_9 97..226 CDD:283167 61/183 (33%)
R12C12.6NP_001040796.1 Tmemb_9 106..260 CDD:283167 53/153 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162212
Domainoid 1 1.000 103 1.000 Domainoid score I4269
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9515
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380345at2759
OrthoFinder 1 1.000 - - FOG0004165
OrthoInspector 1 1.000 - - oto18527
orthoMCL 1 0.900 - - OOG6_105991
Panther 1 1.100 - - LDO PTHR13064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4828
SonicParanoid 1 1.000 - - X2915
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.