DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and Pomt1

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_036018637.1 Gene:Pomt1 / 99011 MGIID:2138994 Length:748 Species:Mus musculus


Alignment Length:173 Identity:50/173 - (28%)
Similarity:70/173 - (40%) Gaps:53/173 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LHSHDVKY------GSGSG-QQSVTGVEQKEDVNSHWVIKAQTGELCERG----------EPIAC 91
            ||||...|      |.||. ||.||....| |:|:.|::|       :.|          .|:..
Mouse   343 LHSHKNTYPMIYENGRGSSHQQQVTCYPFK-DINNWWIVK-------DPGRHQLVVNNPPRPVRH 399

  Fly    92 GSTVRLEHLSTKKNLHSHHFSSPLS-GEQEVSAYGTDGLG---------------DTGDHWEVVC 140
            |..|:|.|..|.:.|::|..::||| ..||||.|....:.               ...|.|:.:.
Mouse   400 GDIVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWKLDIVNRESNRDTWKTIL 464

  Fly   141 SNENWMRSAHVRLRHIDTGMYLGMSGRSYGRPISG--QMEIVG 181
            |        .||..|::|...|.:||...  |..|  |:|:||
Mouse   465 S--------EVRFVHVNTSAILKLSGAHL--PDWGFRQLEVVG 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 16/37 (43%)
MIR 86..138 CDD:197746 19/77 (25%)
MIR 151..>182 CDD:197746 13/33 (39%)
Pomt1XP_036018637.1 PMT1 56..744 CDD:224839 50/173 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.