DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and PMT6

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_011715.1 Gene:PMT6 / 853113 SGDID:S000003431 Length:759 Species:Saccharomyces cerevisiae


Alignment Length:199 Identity:71/199 - (35%)
Similarity:85/199 - (42%) Gaps:44/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LHSHDVKYGSGSGQQSVTGVEQKEDVNSHWVIK---------AQTGELCERGEPIACGSTVRLEH 99
            ||||...|..||||:.:||. ...|.|:.|..:         .|.|.|..:..||..|..|||.|
Yeast   361 LHSHIQVYPEGSGQRQITGY-GFADSNNVWKFEFSRSSGLELDQNGTLNGKIIPITDGVEVRLSH 424

  Fly   100 LSTKKNLHSHHFSSPLS-GEQEVSAYGTDGLGDTGDHWEV-----------VCSNEN----WMRS 148
            .:|..|||||...|.:| |..|||.||:..:||..|.|.|           |.||||    ...|
Yeast   425 KNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVEIVKQMDSPNPVYSNENSTILHPVS 489

  Fly   149 AHVRLRHIDTGMYLGMSGRSYGRPISG--QMEIV---GVHKPQHGTRWT----------TAEGLF 198
            ...||||...|.||..:|.:|  |..|  |.|||   ...:....|.|.          |||. :
Yeast   490 TFFRLRHKVLGCYLASTGLTY--PAWGFKQAEIVCKDSWSRRDKSTWWNVEDHWNHNLETAED-Y 551

  Fly   199 IVPK 202
            :.||
Yeast   552 VPPK 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 14/30 (47%)
MIR 86..138 CDD:197746 25/52 (48%)
MIR 151..>182 CDD:197746 15/35 (43%)
PMT6NP_011715.1 PMT1 44..759 CDD:224839 71/199 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2064
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.