DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and PMT5

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_010190.1 Gene:PMT5 / 851464 SGDID:S000002251 Length:743 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:60/213 - (28%)
Similarity:84/213 - (39%) Gaps:53/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VGSISRGAATESN-VVTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSVTGVEQKEDVNSHWVIK 76
            |..::.|:|...| |.|.|..           ||||...|.:||.||.|| :....|.|:.|:| 
Yeast   320 VAEVAVGSAVSLNHVGTAGGY-----------LHSHLHNYPAGSMQQQVT-LYPHIDQNNKWII- 371

  Fly    77 AQTGELCERG-------EPIACGSTVRLEHLSTKKNLHSHHFSSPLS----GEQEVSAYGTDGL- 129
                ||.|..       :.:..|:.::|..|.....||||....|:|    .::|||.||.:|. 
Yeast   372 ----ELAEHPNENVTSFQNLTDGTIIKLRQLKNGCRLHSHDHKPPVSQNADWQKEVSCYGYEGFE 432

  Fly   130 GDTGDHWEVVCS---NENWMRSAHV-------RLRHIDTGMYLGMSGRSYGRPIS------GQME 178
            ||..|.|.:...   :|......|:       ||:|..||.||      :..|..      ||.|
Yeast   433 GDINDDWIIEIDKKRSEPGPAQEHIRAIETKFRLKHYLTGCYL------FSHPEKLPEWGFGQQE 491

  Fly   179 IVGVHKPQHG-TRWTTAE 195
            :...:..:.. |.|...|
Yeast   492 VTCAYFAREDLTSWYIEE 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 17/48 (35%)
MIR 86..138 CDD:197746 19/63 (30%)
MIR 151..>182 CDD:197746 11/43 (26%)
PMT5NP_010190.1 PMT1 22..729 CDD:224839 60/213 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343445
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2064
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.