DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and SDF2

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_565585.1 Gene:SDF2 / 817049 AraportID:AT2G25110 Length:218 Species:Arabidopsis thaliana


Alignment Length:194 Identity:85/194 - (43%)
Similarity:120/194 - (61%) Gaps:3/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SISRGAATESNV-VTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSVTGVEQKEDVNSHWVIKAQ 78
            |.|..|:.:..| :|.||.:||::....||||||||.||||||||||||.....|.||:|::|..
plant    24 SASAAASGKEGVEITYGSAIKLMHEKTKFRLHSHDVPYGSGSGQQSVTGFPGVVDSNSYWIVKPV 88

  Fly    79 TGELCERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGEQEVSAYGTDGLGDTGDHWEVVC--S 141
            .|...::|:.:..|:|:||:|:.|:|.||||..:||:||..|||.:|.|...||||||:::.  |
plant    89 PGTTEKQGDAVKSGATIRLQHMKTRKWLHSHLHASPISGNLEVSCFGDDTNSDTGDHWKLIIEGS 153

  Fly   142 NENWMRSAHVRLRHIDTGMYLGMSGRSYGRPISGQMEIVGVHKPQHGTRWTTAEGLFIVPKEKS 205
            .:.|.:...|||:||||..||....:.|.|...||.|:.|:.:.:....|..|||:::...|.|
plant   154 GKTWKQDQRVRLQHIDTSGYLHSHDKKYQRIAGGQQEVCGIREKKADNIWLAAEGVYLPLNESS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 30/49 (61%)
MIR 86..138 CDD:197746 27/51 (53%)
MIR 151..>182 CDD:197746 14/30 (47%)
SDF2NP_565585.1 PMT1 <39..>218 CDD:224839 80/179 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2983
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5045
Inparanoid 1 1.050 170 1.000 Inparanoid score I1554
OMA 1 1.010 - - QHG54450
OrthoDB 1 1.010 - - D1534407at2759
OrthoFinder 1 1.000 - - FOG0002719
OrthoInspector 1 1.000 - - oto4148
orthoMCL 1 0.900 - - OOG6_102590
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2096
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.