DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and SDF2

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_011523408.1 Gene:SDF2 / 6388 HGNCID:10675 Length:230 Species:Homo sapiens


Alignment Length:235 Identity:111/235 - (47%)
Similarity:146/235 - (62%) Gaps:32/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILLLTGL-ALVGSISRGAATESNVVTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSVTGVEQKE 67
            :|||.|| :.||:.|.|      ||||||::||||:.:..|||||||:|||||||||||||...:
Human     6 LLLLGGLWSAVGASSLG------VVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVD 64

  Fly    68 DVNSHWVIKAQTGELCERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGEQ------------- 119
            |.||:|.|:.::..:||||.||.||..:||.|::|.:|||||||:|||||.|             
Human    65 DSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQRRKQRLKGFTEEG 129

  Fly   120 ------EVSAYGTDGLGDTGDHWEVVCSNENWMRSAHVRLRHIDTGMYLGMSGRSYGRPISGQME 178
                  ||||:|.:|.||..|.|.|:|:...|:|...||.:|..|.:.|.::|..||||||||.|
Human   130 IKLRFKEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKE 194

  Fly   179 IVGVHKPQHGTRWTTAEGLFIVPKE--KSSTHDEYAHSEL 216
            :.|:.:|.....|...||:|:.|.|  |:..|    |:||
Human   195 VHGMAQPSQNNYWKAMEGIFMKPSELLKAEAH----HAEL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 34/48 (71%)
MIR 86..138 CDD:197746 32/70 (46%)
MIR 151..>182 CDD:197746 15/30 (50%)
SDF2XP_011523408.1 MIR 22..72 CDD:197746 35/55 (64%)
MIR 83..157 CDD:197746 33/73 (45%)
MIR 159..208 CDD:197746 19/48 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4934
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5045
Inparanoid 1 1.050 222 1.000 Inparanoid score I3542
Isobase 1 0.950 - 0 Normalized mean entropy S2064
OMA 1 1.010 - - QHG54450
OrthoDB 1 1.010 - - D1534407at2759
OrthoFinder 1 1.000 - - FOG0002719
OrthoInspector 1 1.000 - - otm41306
orthoMCL 1 0.900 - - OOG6_102590
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 1 1.000 - - X2096
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.720

Return to query results.
Submit another query.