DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and pomt1

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001041532.2 Gene:pomt1 / 569769 ZFINID:ZDB-GENE-060929-966 Length:720 Species:Danio rerio


Alignment Length:196 Identity:64/196 - (32%)
Similarity:88/196 - (44%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LHSHDVKY------GSGSG-QQSVTGVEQKEDVNSHWVIK---AQTGELCERGEPIACGSTVRLE 98
            ||||...|      |.||. ||.||....| |||:.|:||   .|:..:.....|:..|..::|.
Zfish   314 LHSHKANYPIRYENGRGSSHQQQVTCYPFK-DVNNWWIIKDPGRQSLVVSSPPRPVRRGDIIQLL 377

  Fly    99 HLSTKKNLHSHHFSSPLS-GEQEVSAYGTDGLGDTGDH-WEVVCSN-----ENWMR-SAHVRLRH 155
            |..|.:.|::|..::|:| ..||||.|....:.....: |.|...|     |.|.. .:.|||.|
Zfish   378 HGMTTRYLNTHDVAAPMSPHSQEVSGYIDFNVSMPAQNLWRVDIVNRESEKEIWKTILSEVRLVH 442

  Fly   156 IDTGMYLGMSGRSYGRPISGQMEIVG--VHKPQHGT-RWTTAE---GLFIVPKE-----KSSTHD 209
            ::|...|.:||.|.......|:|:||  ::|....| .|...|   |....|||     ||.||.
Zfish   443 VNTSAVLKLSGASLPEWGFKQLEVVGDKIYKGYQQTGMWNVEEHRYGRSQEPKERELELKSPTHS 507

  Fly   210 E 210
            :
Zfish   508 D 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 17/37 (46%)
MIR 86..138 CDD:197746 15/53 (28%)
MIR 151..>182 CDD:197746 13/32 (41%)
pomt1NP_001041532.2 PMT1 27..715 CDD:224839 64/196 (33%)
PMT 27..262 CDD:280519
MIR 293..351 CDD:197746 17/37 (46%)
MIR 365..422 CDD:197746 16/56 (29%)
MIR 436..486 CDD:197746 16/49 (33%)
PMT_4TMC 515..713 CDD:292810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.