DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and tw

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001259102.1 Gene:tw / 31024 FlyBaseID:FBgn0086368 Length:765 Species:Drosophila melanogaster


Alignment Length:174 Identity:56/174 - (32%)
Similarity:85/174 - (48%) Gaps:27/174 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVGSISRGAATESNVVTCGSILKLLN----SDYAFRLHSHDVKY--GSGSGQQSVTGVEQKEDVN 70
            |:|:....|:...: |..||::.:.|    ..|   ||||...|  |||:.||.||....| |.|
  Fly   307 LIGNSLYNASMPRD-VAYGSLVTIKNHKTGGGY---LHSHHHLYPKGSGARQQQVTTYTHK-DEN 366

  Fly    71 SHWVIKAQTGELCERGEP------IACGSTVRLEHLSTKKNLHSHHFSSPLSGEQ-EVSAYGTDG 128
            :.|:|:...    :.|.|      :..|..|||.|::|::|||||:..:|::.:. :|:.||..|
  Fly   367 NKWLIRPHN----KPGPPKGKVQILRHGDLVRLTHMATRRNLHSHNEPAPMTKKHLQVTGYGELG 427

  Fly   129 LGDTGDHWEVVCSNENWMRSAHV---RLR--HIDTGMYLGMSGR 167
            |||..|.|.|:........:.|.   ||:  |:.....|..||:
  Fly   428 LGDANDVWRVLIVGGKVNETVHTVTSRLKFIHLLQNCALTSSGK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 21/54 (39%)
MIR 86..138 CDD:197746 23/58 (40%)
MIR 151..>182 CDD:197746 6/22 (27%)
twNP_001259102.1 PMT1 41..765 CDD:224839 56/174 (32%)
PMT 44..290 CDD:280519
MIR 318..374 CDD:197746 22/60 (37%)
MIR 385..440 CDD:197746 22/54 (41%)
MIR 446..501 CDD:197746 7/26 (27%)
PMT_4TMC 518..763 CDD:292810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447169
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.