DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and POMT2

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_011534977.1 Gene:POMT2 / 29954 HGNCID:19743 Length:813 Species:Homo sapiens


Alignment Length:157 Identity:53/157 - (33%)
Similarity:78/157 - (49%) Gaps:25/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GSILKLLNSDYAF-RLHSHDVKY--GSGSGQQSVTGVEQKEDVNSHWVIKAQTGELCERGEP--- 88
            ||::.:.|...|. .||||...|  |.|:.||.||....| |.|:.|:||...    ...:|   
Human   340 GSVITVKNLRMAIGYLHSHRHLYPEGIGARQQQVTTYLHK-DYNNLWIIKKHN----TNSDPLDP 399

  Fly    89 ------IACGSTVRLEHLSTKKNLHSHHFSSPLSGEQ-EVSAYGTDGLGDTGDHWEVVCSNENW- 145
                  :..|..:||||..|.:|||||:..:|::.:. :|:.||.:|.||:.|.|.:...|..: 
Human   400 SFPVEFVRHGDIIRLEHKETSRNLHSHYHEAPMTRKHYQVTGYGINGTGDSNDFWRIEVVNRKFG 464

  Fly   146 -----MRSAHVRLRHIDTGMYLGMSGR 167
                 :|| .:|..|:.||..||.||:
Human   465 NRIKVLRS-RIRFIHLVTGCVLGSSGK 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 19/47 (40%)
MIR 86..138 CDD:197746 21/61 (34%)
MIR 151..>182 CDD:197746 8/17 (47%)
POMT2XP_011534977.1 PMT1 50..813 CDD:224839 53/157 (34%)
PMT 62..306 CDD:280519
MIR 334..390 CDD:197746 21/50 (42%)
MIR 404..459 CDD:197746 20/54 (37%)
MIR 472..521 CDD:197746 9/20 (45%)
PMT_4TMC 538..811 CDD:292810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.