DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and ogm2

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_594135.1 Gene:ogm2 / 2543657 PomBaseID:SPAPB1E7.09 Length:739 Species:Schizosaccharomyces pombe


Alignment Length:221 Identity:68/221 - (30%)
Similarity:93/221 - (42%) Gaps:30/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AATESNVVTCGSILKLLNSDYAFR--------LHSHDVKYGSGSGQQSVTGVEQKEDVNSHWVIK 76
            |..|.:.:|...|..:..|.:..:        ||||...|..||.||.|||...| |.|:.|:..
pombe   321 ARLEGSPLTKNPIDLMYGSKFTLKSRNPTGALLHSHVQTYPEGSEQQQVTGYHHK-DGNNEWMFV 384

  Fly    77 AQTG-----ELCERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGEQ-EVSAYGTDGLGDTGDH 135
            ...|     |..:...||..||.|||.|..|.:|||:|...:||:... |||.||...:||..|:
pombe   385 PTHGVAYNYEENDPMNPILNGSVVRLIHPFTNRNLHTHKIPAPLNKRMYEVSGYGLGDVGDEKDY 449

  Fly   136 WEVVCSNENWMRSAHVRLRHIDT---------GMYLGMSGRSYGRPISGQMEIVGVHKPQHG--- 188
            |.|....:...|.|: .:|.:.|         |.||..|..|......||:|:.....|...   
pombe   450 WIVNILYDTAHRDAY-NVRSLSTVFQLYNPVVGCYLSSSSSSLPSWGFGQIEMYCDPDPDPSNTD 513

  Fly   189 TRWTTAEGLFIVPKEKSSTHDEYAHS 214
            |:|...|  .|.|:....:.::|..|
pombe   514 TQWNVEE--HINPRLPEGSINDYPSS 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 19/56 (34%)
MIR 86..138 CDD:197746 24/52 (46%)
MIR 151..>182 CDD:197746 10/39 (26%)
ogm2NP_594135.1 PMT1 34..739 CDD:224839 68/221 (31%)
PMT 63..306 CDD:280519
MIR 332..385 CDD:197746 18/53 (34%)
MIR 405..454 CDD:197746 23/48 (48%)
PMT_4TMC 538..735 CDD:292810 68/221 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.