DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11999 and R12E2.13

DIOPT Version :9

Sequence 1:NP_649527.1 Gene:CG11999 / 40637 FlyBaseID:FBgn0037312 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_491320.1 Gene:R12E2.13 / 172010 WormBaseID:WBGene00020038 Length:206 Species:Caenorhabditis elegans


Alignment Length:186 Identity:94/186 - (50%)
Similarity:127/186 - (68%) Gaps:1/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AATESNVVTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSVTGVEQKEDVNSHWVIKAQTGELCE 84
            |..:.:.|||.|:||.:|::...|||||||||||||||||||.|:..:|:||||.|.......|.
 Worm    19 AYADEDFVTCYSVLKFINANDGSRLHSHDVKYGSGSGQQSVTAVKNSDDINSHWQIFPALNAKCN 83

  Fly    85 RGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGE-QEVSAYGTDGLGDTGDHWEVVCSNENWMRS 148
            ||:.|.||..:||:||:|...||||||::|||.: |||||:|::...||||.|.|:|:.:.|:.|
 Worm    84 RGDAIKCGDKIRLKHLTTGTFLHSHHFTAPLSKQHQEVSAFGSEAESDTGDDWTVICNGDEWLES 148

  Fly   149 AHVRLRHIDTGMYLGMSGRSYGRPISGQMEIVGVHKPQHGTRWTTAEGLFIVPKEK 204
            ...:|||..||.||.:||:.:||||.||.|:||......|:.|..|||::|..::|
 Worm   149 EQFKLRHAVTGSYLSLSGQQFGRPIHGQREVVGTDSITGGSAWKVAEGIYIKHQQK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11999NP_649527.1 MIR 26..75 CDD:197746 32/48 (67%)
MIR 86..138 CDD:197746 29/52 (56%)
MIR 151..>182 CDD:197746 17/30 (57%)
R12E2.13NP_491320.1 MIR 23..77 CDD:197746 33/53 (62%)
MIR 34..180 CDD:280906 78/145 (54%)
MIR 85..141 CDD:197746 30/55 (55%)
MIR 143..195 CDD:197746 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I3667
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5045
Inparanoid 1 1.050 205 1.000 Inparanoid score I2434
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54450
OrthoDB 1 1.010 - - D1534407at2759
OrthoFinder 1 1.000 - - FOG0002719
OrthoInspector 1 1.000 - - oto18888
orthoMCL 1 0.900 - - OOG6_102590
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2235
SonicParanoid 1 1.000 - - X2096
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.