DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acbd4 and anox

DIOPT Version :9

Sequence 1:NP_998260.1 Gene:acbd4 / 406368 ZFINID:ZDB-GENE-040426-2074 Length:403 Species:Danio rerio
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:253 Identity:61/253 - (24%)
Similarity:94/253 - (37%) Gaps:80/253 - (31%)


- Green bases have known domain annotations that are detailed below.


Zfish    20 VDVIQSLPKNGTYKPSYEV----MLRFYGLFKQAVCGPCTLSRPGFWDPVGRYKWEAWSNLGEMS 80
            ||.:..|......|.|..:    :|.|||.:|||..|||....||......:.||:||.|||.||
  Fly     9 VDELFHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMS 73

Zfish    81 RETAMAAYVDEMKKVAQDVIDTMQIN---EKNASYFHYFEPLYHVIHDMPRPPEALFSLSSDVNV 142
            :..|..|||.::::        :|.|   .:|..:      :.|.|..:|...:.|.|       
  Fly    74 QSAARQAYVQKLQE--------LQPNWRSRRNPGW------VVHSIESVPLEDQRLDS------- 117

Zfish   143 KEPTGGVFKHNVDSATQEPRLQQDTETSLNSELQPQ----------------------------- 178
             |.|  :|.|          ::::....|...|||.                             
  Fly   118 -EKT--LFDH----------VKENNLDRLRELLQPSDLVKLDEHGMALIHWATDRNAVEIIQFLV 169

Zfish   179 ----STEQRMSECQGPISDTESEVFCDSLEQMD-NIKLTAVPDGNSPFQNGRTCIEIS 231
                |..||.:|.|.|:....|   |..||.:. .::|.|..:...  .:|:||.:::
  Fly   170 RSGASVNQRDAEQQTPLHYAAS---CGHLEALQCLLELHASLELRD--SDGQTCYDVA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acbd4NP_998260.1 ACBP 13..96 CDD:279259 30/79 (38%)
anoxNP_001027085.1 ACBP 10..90 CDD:279259 29/87 (33%)
ANK 125..231 CDD:238125 19/103 (18%)
Ank_2 125..212 CDD:289560 16/89 (18%)
ANK repeat 148..179 CDD:293786 2/30 (7%)
ANK repeat 181..212 CDD:293786 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.