Sequence 1: | NP_998260.1 | Gene: | acbd4 / 406368 | ZFINID: | ZDB-GENE-040426-2074 | Length: | 403 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001027085.1 | Gene: | anox / 3771728 | FlyBaseID: | FBgn0064116 | Length: | 243 | Species: | Drosophila melanogaster |
Alignment Length: | 253 | Identity: | 61/253 - (24%) |
---|---|---|---|
Similarity: | 94/253 - (37%) | Gaps: | 80/253 - (31%) |
- Green bases have known domain annotations that are detailed below.
Zfish 20 VDVIQSLPKNGTYKPSYEV----MLRFYGLFKQAVCGPCTLSRPGFWDPVGRYKWEAWSNLGEMS 80
Zfish 81 RETAMAAYVDEMKKVAQDVIDTMQIN---EKNASYFHYFEPLYHVIHDMPRPPEALFSLSSDVNV 142
Zfish 143 KEPTGGVFKHNVDSATQEPRLQQDTETSLNSELQPQ----------------------------- 178
Zfish 179 ----STEQRMSECQGPISDTESEVFCDSLEQMD-NIKLTAVPDGNSPFQNGRTCIEIS 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
acbd4 | NP_998260.1 | ACBP | 13..96 | CDD:279259 | 30/79 (38%) |
anox | NP_001027085.1 | ACBP | 10..90 | CDD:279259 | 29/87 (33%) |
ANK | 125..231 | CDD:238125 | 19/103 (18%) | ||
Ank_2 | 125..212 | CDD:289560 | 16/89 (18%) | ||
ANK repeat | 148..179 | CDD:293786 | 2/30 (7%) | ||
ANK repeat | 181..212 | CDD:293786 | 9/33 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |