DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and TIM17-2

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_181277.1 Gene:TIM17-2 / 818317 AraportID:AT2G37410 Length:243 Species:Arabidopsis thaliana


Alignment Length:170 Identity:77/170 - (45%)
Similarity:100/170 - (58%) Gaps:16/170 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGNFA 67
            |..|||||.||::|.||||.|||:||.||..|||..|:|.  |.|..||..:|...:...||:||
plant     5 ETSREPCPDRILDDIGGAFGMGAVGGSAFHFIKGTYNSPK--GSRFVGGTQSVSMNAPRTGGSFA 67

  Fly    68 VWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVGIV 132
            |||..||..||::||.|:||||||:||:||.|||.|:.|.|..:...||:.||.|||||||.||:
plant    68 VWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGAGAASRSAIFGGVLLALIEGAGIM 132

  Fly   133 VSHYSADSYRQVSPVERQQRYKQELLRQQKGVSPLAATYG 172
            ::...|.              .|.::.:..|:..:....|
plant   133 LNKVLAQ--------------PQNMMMEDPGMQGMPGMQG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 74/143 (52%)
TIM17-2NP_181277.1 Tim17 7..147 CDD:295283 74/155 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 130 1.000 Domainoid score I1702
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1558
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm1125
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X753
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.