DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and timm17b

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001072242.1 Gene:timm17b / 779691 XenbaseID:XB-GENE-6454019 Length:156 Species:Xenopus tropicalis


Alignment Length:146 Identity:90/146 - (61%)
Similarity:116/146 - (79%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:|||:||||||.||.:|||.|||:|||||||:|:.:||.|.::|||.|:..:||:
 Frog     1 MEEYMREPCPWRIVDDCGGAFTMGIIGGGVFQAVKGFRNAPAGVAHRLRGSMSAVRIRAPQIGGS 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            |||||..||.|||.||..|.||||||:|.|||.||.:||:|:|..:|:.|||:||.|||||||||
 Frog    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLASRSGPLAMVGSALMGGILLALIEGVG 130

  Fly   131 IVVSHYSADSYRQVSP 146
            |:::.|:|..::..:|
 Frog   131 ILLTRYTAQQFQNPNP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 90/146 (62%)
timm17bNP_001072242.1 Tim17 1..146 CDD:321914 89/144 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.