DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and timm17a

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001011183.1 Gene:timm17a / 496605 XenbaseID:XB-GENE-979217 Length:167 Species:Xenopus tropicalis


Alignment Length:147 Identity:88/147 - (59%)
Similarity:111/147 - (75%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:|||:||||||.||.:|||.|||||||||:|.||.:|..|.|.::|.|:..:||:
 Frog     1 MEEYTREPCPWRIVDDCGGAFTMGMIGGGIFQAIKGFRNSPQGLKHRFKGSLISIRTRAPQLGGS 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            |||||..||.||||:|..|.||||||:|.|||.||.|||||.|..:|:.||.:||.|||||||.|
 Frog    66 FAVWGGLFSMIDCSMVKMRGKEDPWNSITSGALTGAILAARNGAVAMVGSAAMGGILLALIEGAG 130

  Fly   131 IVVSHYSADSYRQVSPV 147
            |.::.:::..:..|:|:
 Frog   131 ICITRFASSQFTNVAPI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 87/145 (60%)
timm17aNP_001011183.1 Tim17 1..167 CDD:382951 88/147 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.