DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and Tim17a2

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster


Alignment Length:158 Identity:84/158 - (53%)
Similarity:113/158 - (71%) Gaps:5/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGNFA 67
            ||.|:|||.|||||||.||.||.:||..||.:||||||||||...|.||:.:||.|:..:.|:||
  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIESVRLRTPAIAGSFA 66

  Fly    68 VWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVGIV 132
            :||||||.:||.:|.:|::||.||||:|||.||||||||.|:.:|.:||.||..:||::||.|..
  Fly    67 IWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCLVLAMLEGAGAA 131

  Fly   133 VSH-YSAD----SYRQVSPVERQQRYKQ 155
            |:. |::|    :...:..|::|.:..|
  Fly   132 VATIYASDGGVKAEESLITVDQQMQRPQ 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 81/148 (55%)
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 77/126 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456965
Domainoid 1 1.000 130 1.000 Domainoid score I1702
eggNOG 1 0.900 - - E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1558
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm1125
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
109.900

Return to query results.
Submit another query.