DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and Tim17b

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001015401.1 Gene:Tim17b / 3355107 FlyBaseID:FBgn0263977 Length:173 Species:Drosophila melanogaster


Alignment Length:149 Identity:100/149 - (67%)
Similarity:120/149 - (80%) Gaps:1/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:|||:|||||||||.:|||.||||||||||||||..||.|.:.|::.||.::.||
  Fly     1 MEEYAREPCPYRIVDDCGGAFAMGCIGGGVFQAIKGFRNAPSGLNRRLVGSIIAIKTRSPVIAGN 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            |||||..||.|||:||:|||||||||:|||||.||||||||.|:.:|..||::||.|||||||||
  Fly    66 FAVWGGMFSTIDCTLVHFRKKEDPWNSIISGAATGGILAARNGVPAMAGSAIIGGVLLALIEGVG 130

  Fly   131 IVVSHYSADSYRQ-VSPVE 148
            |:.:..|||.::. :.|.|
  Fly   131 ILFTRISADQFKNPIPPAE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 98/146 (67%)
Tim17bNP_001015401.1 Tim17 1..155 CDD:295283 100/149 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456972
Domainoid 1 1.000 130 1.000 Domainoid score I1702
eggNOG 1 0.900 - - E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1558
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm1125
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - P PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
1110.800

Return to query results.
Submit another query.