DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and Timm17b

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_038955701.1 Gene:Timm17b / 317374 RGDID:1561744 Length:199 Species:Rattus norvegicus


Alignment Length:173 Identity:90/173 - (52%)
Similarity:112/173 - (64%) Gaps:27/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:|||:||||||.||.:|||.|||:|||||||.|:.:|..|.:.|||.|:..:||:
  Rat     1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAVKGFRNAPVGIRHRFRGSINAVRIRAPQIGGS 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAART----------------------- 107
            |||||..||.|||.||..|.||||||:|.|||.||.:||||:                       
  Rat    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSECFQPLTPVLALFCLPFLSCVSF 130

  Fly   108 ----GLTSMLSSALVGGALLALIEGVGIVVSHYSADSYRQVSP 146
                |..:|:.||::||.||||||||||:::.|:|..:|...|
  Rat   131 CLPGGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 90/173 (52%)
Timm17bXP_038955701.1 Tim17 1..198 CDD:413300 90/173 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X753
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.720

Return to query results.
Submit another query.