DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and tim17

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_593342.1 Gene:tim17 / 2543163 PomBaseID:SPAC3A12.16c Length:164 Species:Schizosaccharomyces pombe


Alignment Length:146 Identity:67/146 - (45%)
Similarity:98/146 - (67%) Gaps:2/146 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGNF 66
            |::.|:|||:.|:.|.|.||:||.:||..:.:|||:||:|.| ..|:| .:||.:.|:.::||||
pombe     4 ADHTRDPCPYVILNDFGAAFSMGTIGGAIWHSIKGWRNSPPG-EKRIS-AIAAAKTRAPVLGGNF 66

  Fly    67 AVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVGI 131
            .|||..||..||::...|:|||||||||:|..|||.||.|.|..:..:.|:....:||:.||:||
pombe    67 GVWGGLFSTFDCAVKGVRRKEDPWNAIIAGFFTGGALAVRGGWRATRNGAIGCACILAVFEGLGI 131

  Fly   132 VVSHYSADSYRQVSPV 147
            .:...:|:..|.|:||
pombe   132 ALGRMNAEYNRPVAPV 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 65/144 (45%)
tim17NP_593342.1 Tim17 3..162 CDD:295283 67/146 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1485
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1309
OMA 1 1.010 - - QHG54844
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - otm47021
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.