DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and Timm17a

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_035720.1 Gene:Timm17a / 21854 MGIID:1343131 Length:171 Species:Mus musculus


Alignment Length:141 Identity:85/141 - (60%)
Similarity:108/141 - (76%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65
            |.||.|||||:|||:||||||.||.:|||.|||.|||||:|.|:.:||.|.|.|::.|:..:||:
Mouse     1 MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGINHRLRGSLTAIKTRAPQLGGS 65

  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130
            |||||..||.||||:|..|.||||||:|.|||.||.|||||.|..:|:.||.:||.|||||||.|
Mouse    66 FAVWGGLFSTIDCSMVQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAG 130

  Fly   131 IVVSHYSADSY 141
            |:::.:::..:
Mouse   131 ILLTRFASAQF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 85/141 (60%)
Timm17aNP_035720.1 3a0801so1tim17 1..171 CDD:130053 85/141 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842463
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54844
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.