DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b1 and TIMM17B

DIOPT Version :9

Sequence 1:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001161419.1 Gene:TIMM17B / 10245 HGNCID:17310 Length:222 Species:Homo sapiens


Alignment Length:196 Identity:92/196 - (46%)
Similarity:112/196 - (57%) Gaps:50/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAP------------------------ 41
            |.||.|||||:|||:||||||.||.:|||.|||||||||||                        
Human     1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVCRLLSEAPLFIYSCSRSVSPTVN 65

  Fly    42 --------------------------SGLGYRLSGGLAAVRARSGLVGGNFAVWGATFSAIDCSL 80
                                      .|:.:||.|...|||.|:..:||:|||||..||.|||.|
Human    66 VSSERAESRPTLFMAVSLHMAWCLAHIGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGL 130

  Fly    81 VYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVGIVVSHYSADSYRQVS 145
            |..|.||||||:|.|||.||.:||||:|..:|:.||::||.||||||||||:::.|:|..:|...
Human   131 VRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAP 195

  Fly   146 P 146
            |
Human   196 P 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 92/196 (47%)
TIMM17BNP_001161419.1 Tim17 1..221 CDD:295283 92/196 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152396
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.