DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hph and egln2

DIOPT Version :9

Sequence 1:NP_001287171.1 Gene:Hph / 40633 FlyBaseID:FBgn0264785 Length:478 Species:Drosophila melanogaster
Sequence 2:XP_688016.4 Gene:egln2 / 559569 ZFINID:ZDB-GENE-060503-757 Length:464 Species:Danio rerio


Alignment Length:393 Identity:151/393 - (38%)
Similarity:202/393 - (51%) Gaps:77/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LNSSNNNKQQQR-------QQIQQLQQAVASANLE-----CS--GAGANCSTAQMMTPAHQAQSW 125
            |.|..:|:..:|       :|||. |:.....|.:     ||  |:|:.||:.  ..|.|:.:..
Zfish   101 LTSHGDNRPMKRPIGELRFRQIQH-QRRKDEENRDFGTNGCSANGSGSGCSSE--TDPIHECKRR 162

  Fly   126 PAEVDNLLNLLGQPGSQEKAAAAETETGQRQQ-------QHQH-----HHHNGEKSSSYQIGLAD 178
            ..|:|                 ::|::.:..:       .|||     .|.||...:.:::.|..
Zfish   163 KVEID-----------------SKTDSSKSMRTVPPLAANHQHKNCSASHPNGVYHNGHKVALNH 210

  Fly   179 ASFMGSGSERRYEDL---C-------RNIISDMNQYGLSVVDDFLGMETGLKILNEVRSMYNAGA 233
            .: .|....|....|   |       :.|:..|..||:.|.|.|||...|.:::.||:::..:|.
Zfish   211 VA-PGQAEVRTAPPLVATCSPEHMAQQYIVPCMKFYGICVKDTFLGERLGSRVVEEVQTLNRSGK 274

  Fly   234 FQDGQVVTNQTPDAPAVRGDKIRGDKIKWVGGNEPGCSNVWYLTNQIDSVVYRVNTMKDNGILGN 298
            |:.||:|..:.     :....||||:|.||.||||||.|:..|...||..:.|   ...||.||:
Zfish   275 FRGGQLVIQKN-----IPSKNIRGDQIAWVEGNEPGCENIGTLMAHIDEAIMR---SAANGQLGD 331

  Fly   299 YHIRERTRAMVACYPGSGTHYVMHVDNPQKDGRVITAIYYLNINWDARESGGILRIRPTPGTTVA 363
            ..|..||:|||||||||||.||.|||||..|||.||.|||||.|||.:..||:|:|.|.....||
Zfish   332 CVINGRTQAMVACYPGSGTGYVRHVDNPNGDGRCITCIYYLNKNWDVKVHGGLLQIYPEGRNVVA 396

  Fly   364 DIEPKFDRLIFFWSDIRNPHEVQPAHRTRYAITVWYFDAKEREEALIRAKL------------EN 416
            :|||.||||:.||||.||||||.||..|||||||||||||||.||..:.:|            ::
Zfish   397 NIEPVFDRLLIFWSDRRNPHEVMPAFATRYAITVWYFDAKERAEAKEKYRLASGQKGVQVPVTQS 461

  Fly   417 SKT 419
            |||
Zfish   462 SKT 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HphNP_001287171.1 zf-MYND 30..67 CDD:280009
P4Hc 220..400 CDD:214780 97/179 (54%)
egln2XP_688016.4 P4Hc 255..433 CDD:214780 99/185 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4348
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604981at2759
OrthoFinder 1 1.000 - - FOG0001437
OrthoInspector 1 1.000 - - otm24982
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12907
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X899
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.