DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hph and egln3

DIOPT Version :9

Sequence 1:NP_001287171.1 Gene:Hph / 40633 FlyBaseID:FBgn0264785 Length:478 Species:Drosophila melanogaster
Sequence 2:XP_005169871.1 Gene:egln3 / 406602 ZFINID:ZDB-GENE-040426-2541 Length:271 Species:Danio rerio


Alignment Length:212 Identity:114/212 - (53%)
Similarity:144/212 - (67%) Gaps:10/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 IISDMNQYGLSVVDDFLGMETGLKILNEVRSMYNAGAFQDGQVVTNQTPDAPAVRGDKIRGDKIK 261
            ::..||.|||.::|.|||...|.::|.|||.::.:|..||||:.:.:...:.|     ||||||.
Zfish    55 VVPCMNSYGLCIIDRFLGDRIGERVLQEVRRIHQSGGMQDGQLASQKLDKSKA-----IRGDKIA 114

  Fly   262 WVGGNEPGCSNVWYLTNQIDSVVYRVNTMKDNGILGNYHIRERTRAMVACYPGSGTHYVMHVDNP 326
            ||||.|..|.|:.||..::|.::    |..| |.|..:.|..|.:||||||||:|..||.|||||
Zfish   115 WVGGTEGSCQNIGYLLTRMDKLI----TCAD-GRLDKFKITGRHKAMVACYPGNGAGYVKHVDNP 174

  Fly   327 QKDGRVITAIYYLNINWDARESGGILRIRPTPGTTVADIEPKFDRLIFFWSDIRNPHEVQPAHRT 391
            ..|||.:|.|||||.||:|:|.||:|||.|.....||||||.||||:.||||.||||||||::.|
Zfish   175 NADGRCVTCIYYLNKNWNAKEHGGLLRIFPEGKPYVADIEPLFDRLLLFWSDRRNPHEVQPSYAT 239

  Fly   392 RYAITVWYFDAKEREEA 408
            ||||||||||::||.||
Zfish   240 RYAITVWYFDSEERAEA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HphNP_001287171.1 zf-MYND 30..67 CDD:280009
P4Hc 220..400 CDD:214780 97/179 (54%)
egln3XP_005169871.1 P4Hc 72..248 CDD:214780 99/185 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4348
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604981at2759
OrthoFinder 1 1.000 - - FOG0001437
OrthoInspector 1 1.000 - - otm24982
orthoMCL 1 0.900 - - OOG6_104186
Panther 1 1.100 - - O PTHR12907
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3122
SonicParanoid 1 1.000 - - X899
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.950

Return to query results.
Submit another query.