DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hph and egln3

DIOPT Version :9

Sequence 1:NP_001287171.1 Gene:Hph / 40633 FlyBaseID:FBgn0264785 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001120484.1 Gene:egln3 / 100145602 XenbaseID:XB-GENE-964334 Length:252 Species:Xenopus tropicalis


Alignment Length:236 Identity:118/236 - (50%)
Similarity:146/236 - (61%) Gaps:26/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 GLSVVDDFLGMETGLKILNEVRSMYNAGAFQDGQVVTNQTPDAPAVRGDKIRGDKIKWVGGNEPG 269
            |...:|:|||.|.|.::|.:||.:|..||.:|||:..:    ...|....:|||||.||.|.|.|
 Frog    39 GYCYLDNFLGEEIGNRVLEKVRRLYQDGALKDGQLAGH----LQGVSKKHLRGDKIAWVAGTEEG 99

  Fly   270 CSNVWYLTNQIDSVVYRVNTMKDNGILGNYHIRERTRAMVACYPGSGTHYVMHVDNPQKDGRVIT 334
            |..:..:.:.||.:|     |.....||.|:::||::||||||||:|..||.|||||..|||.||
 Frog   100 CEAIGLVLSVIDRLV-----MLCGNRLGQYYVKERSKAMVACYPGNGAGYVRHVDNPTGDGRCIT 159

  Fly   335 AIYYLNINWDARESGGILRIRPTPGTTVADIEPKFDRLIFFWSDIRNPHEVQPAHRTRYAITVWY 399
            .|||||.:|||:..||||||.|..|..||||||.||||:|||||.||||||||::.||||:||||
 Frog   160 CIYYLNKDWDAKIHGGILRIFPEGGPHVADIEPLFDRLLFFWSDRRNPHEVQPSYSTRYALTVWY 224

  Fly   400 FDAKEREEALIRAKLENSKTNNLAAQAQAQQAEPDSTTTPP 440
            ||||||                 ||..|..:...:||..||
 Frog   225 FDAKER-----------------AAAKQKFKRLSESTEEPP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HphNP_001287171.1 zf-MYND 30..67 CDD:280009
P4Hc 220..400 CDD:214780 97/179 (54%)
egln3NP_001120484.1 P4Hc 54..225 CDD:214780 97/179 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4505
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604981at2759
OrthoFinder 1 1.000 - - FOG0001437
OrthoInspector 1 1.000 - - otm48835
Panther 1 1.100 - - O PTHR12907
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X899
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.