DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and TIM17

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_012392.1 Gene:TIM17 / 853298 SGDID:S000003679 Length:158 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:58/128 - (45%)
Similarity:83/128 - (64%) Gaps:2/128 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIESVRLRTPAIAGSFA 66
            :::|.||||.|:.|.|.||.||.:||.::..:|||||:|.| .|| .|.:.:::.|.|.:.|:|.
Yeast     4 DHSRDPCPIVILNDFGGAFAMGAIGGVVWHGIKGFRNSPLG-ERG-SGAMSAIKARAPVLGGNFG 66

  Fly    67 IWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCLVLAMLEGAG 129
            :||..|||.||.:.:.|:|||.||||::|..|||.||.|.|.|...||:.....:|.::||.|
Yeast    67 VWGGLFSTFDCAVKAVRKREDPWNAIIAGFFTGGALAVRGGWRHTRNSSITCACLLGVIEGVG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 57/126 (45%)
TIM17NP_012392.1 3a0801so1tim17 2..158 CDD:130053 58/128 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344795
Domainoid 1 1.000 120 1.000 Domainoid score I1257
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I1087
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - otm46543
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.