DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and TIM17-2

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_181277.1 Gene:TIM17-2 / 818317 AraportID:AT2G37410 Length:243 Species:Arabidopsis thaliana


Alignment Length:145 Identity:69/145 - (47%)
Similarity:94/145 - (64%) Gaps:2/145 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIESVRLRTPAIAGSFA 66
            |.:|:|||.||::|.|.||.||.:|||.|.::||..|:|.|.|  ..||.:||.:..|...||||
plant     5 ETSREPCPDRILDDIGGAFGMGAVGGSAFHFIKGTYNSPKGSR--FVGGTQSVSMNAPRTGGSFA 67

  Fly    67 IWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCLVLAMLEGAGAA 131
            :||..|||.||.||..||:||.||:|::||||||.|:.|.|..|.:.||..|.::||::||||..
plant    68 VWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGAGAASRSAIFGGVLLALIEGAGIM 132

  Fly   132 VATIYASDGGVKAEE 146
            :..:.|....:..|:
plant   133 LNKVLAQPQNMMMED 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 65/126 (52%)
TIM17-2NP_181277.1 Tim17 7..147 CDD:295283 67/141 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 130 1.000 Domainoid score I1702
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1558
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm1125
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X753
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.