DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and timm17b

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001072242.1 Gene:timm17b / 779691 XenbaseID:XB-GENE-6454019 Length:156 Species:Xenopus tropicalis


Alignment Length:157 Identity:78/157 - (49%)
Similarity:103/157 - (65%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIESVRLRTPAIAGSFA 66
            ||.|:|||.|||:|||.||.||.:||.:||.:|||||||:|:...|.|.:.:||:|.|.|.||||
 Frog     3 EYMREPCPWRIVDDCGGAFTMGIIGGGVFQAVKGFRNAPAGVAHRLRGSMSAVRIRAPQIGGSFA 67

  Fly    67 IWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCLVLAMLEGAGAA 131
            :||..|||:||.:|..|.:||.||:|.|||.||.:||:|:|..||..||.:|.::||::||.| .
 Frog    68 VWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLASRSGPLAMVGSALMGGILLALIEGVG-I 131

  Fly   132 VATIYASDGGVKAEESLITVDQQMQRP 158
            :.|.|.:              ||.|.|
 Frog   132 LLTRYTA--------------QQFQNP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 71/126 (56%)
timm17bNP_001072242.1 Tim17 1..146 CDD:321914 78/157 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.