DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and timm17b

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001107065.1 Gene:timm17b / 562144 ZFINID:ZDB-GENE-081104-144 Length:167 Species:Danio rerio


Alignment Length:160 Identity:82/160 - (51%)
Similarity:106/160 - (66%) Gaps:4/160 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIESVRLRTPAIAGSFA 66
            ||.|:|||.|||:|||.||.||.:||.:||.:|||||||.|:|..|.|...:||:|.|.|.||||
Zfish     3 EYAREPCPWRIVDDCGGAFTMGAIGGGVFQTVKGFRNAPVGVRHRLRGSANAVRVRAPQIGGSFA 67

  Fly    67 IWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCLVLAMLEGAGAA 131
            :||..|||:||.:|..|.:||.||:|.|||.||.|||||:|..||..||.:|.::||::||.| .
Zfish    68 VWGGLFSTIDCGLVRLRGKEDPWNSITSGAMTGAILAARSGPLAMVGSAMMGGILLALIEGFG-I 131

  Fly   132 VATIYASDGGVKAEESLITVDQQMQRPQWE 161
            :.|.|.:.   :.:.|...|:...|.|..|
Zfish   132 LLTRYTAQ---QFQNSSPIVEDPKQLPPKE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 74/126 (59%)
timm17bNP_001107065.1 Tim17 1..167 CDD:295283 82/160 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586875
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.