DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and timm22

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001011397.1 Gene:timm22 / 496870 XenbaseID:XB-GENE-5754351 Length:186 Species:Xenopus tropicalis


Alignment Length:159 Identity:44/159 - (27%)
Similarity:66/159 - (41%) Gaps:51/159 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PCPI---------RIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIES-------VR 55
            |.||         |::|.||....:..:||.:.....|...|          ||::       ..
 Frog    43 PTPIKSEEQKMMERVMESCGFKAALACVGGFVLGGAFGVFTA----------GIDTNVGFDPKDP 97

  Fly    56 LRTP--------------AIAGSFAIWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARN 106
            .|||              :.|.:|||.||.||..:|::.|||.:.|..|:::||..|||.:..|.
 Frog    98 YRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLVESYRGKSDWKNSVISGCITGGAIGFRA 162

  Fly   107 GIRAMANSAFVGCLVLAMLEGAGAAVATI 135
            |::|.|    :||       |..||.:.:
 Frog   163 GLKAGA----LGC-------GGFAAFSAV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 42/151 (28%)
timm22NP_001011397.1 Tim17 60..182 CDD:280604 39/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.