DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and CG31229

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_732364.1 Gene:CG31229 / 318636 FlyBaseID:FBgn0051229 Length:195 Species:Drosophila melanogaster


Alignment Length:144 Identity:40/144 - (27%)
Similarity:60/144 - (41%) Gaps:31/144 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PIRI-----------VEDCG--C--AFMMG-TMGGSLFQYLKG--------FRNAPSGLRRGLHG 49
            |::|           ||.||  |  |.:|| .:|.:|..:...        |.|......|.:  
  Fly    51 PVKIKTNEEKFIETAVESCGFKCTMACVMGYGLGAALGLFSASVNPNMADPFANEKKQTAREV-- 113

  Fly    50 GIESVRLRTPAIAGSFAIWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARNGIRAMANS 114
             ...:|..|.:.|.:||:.|..||.|:|.:.|:|...|..|...:|..|||::..|.|::|    
  Fly   114 -FREMRSTTHSYAKNFALIGCVFSAVECTIESHRGVTDWKNGTYAGGITGGLIGLRAGVKA---- 173

  Fly   115 AFVGCLVLAMLEGA 128
            ..:|.|..|....|
  Fly   174 GIIGGLGFAAFSTA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 40/144 (28%)
CG31229NP_732364.1 Tim17 68..189 CDD:280604 36/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.