DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and Timm17b

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_038955701.1 Gene:Timm17b / 317374 RGDID:1561744 Length:199 Species:Rattus norvegicus


Alignment Length:155 Identity:74/155 - (47%)
Similarity:94/155 - (60%) Gaps:27/155 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAPSGLRRGLHGGIESVRLRTPAIAGSFA 66
            ||.|:|||.|||:|||.||.||.:||.:||.:|||||||.|:|....|.|.:||:|.|.|.||||
  Rat     3 EYAREPCPWRIVDDCGGAFTMGVIGGGVFQAVKGFRNAPVGIRHRFRGSINAVRIRAPQIGGSFA 67

  Fly    67 IWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARN------------------------- 106
            :||..|||:||.:|..|.:||.||:|.|||.||.:||||:                         
  Rat    68 VWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSECFQPLTPVLALFCLPFLSCVSFCL 132

  Fly   107 --GIRAMANSAFVGCLVLAMLEGAG 129
              |..||..||.:|.::||::||.|
  Rat   133 PGGPLAMVGSAMMGGILLALIEGVG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 73/153 (48%)
Timm17bXP_038955701.1 Tim17 1..198 CDD:413300 74/155 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345893
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X753
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.