DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and TIMM22

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_037469.2 Gene:TIMM22 / 29928 HGNCID:17317 Length:194 Species:Homo sapiens


Alignment Length:156 Identity:40/156 - (25%)
Similarity:53/156 - (33%) Gaps:69/156 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LFQYLKGFRNAPSGLRRGLHGGIESVR-------------------------------------- 55
            |.|||.|.:..|..|..|..|||.|..                                      
Human    28 LLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTA 92

  Fly    56 -------------LRTP--------------AIAGSFAIWGATFSTVDCVMVSYRQREDSWNAIV 93
                         .|||              :.|.:|||.||.||..:|::.|||...|..|:::
Human    93 GIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVI 157

  Fly    94 SGAATGGILAARNGIRAMANSAFVGC 119
            ||..|||.:..|.|::|.|    :||
Human   158 SGCITGGAIGFRAGLKAGA----IGC 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 40/156 (26%)
TIMM22NP_037469.2 Tim17 69..186 CDD:396842 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.