DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and timm-17B.2

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001367715.1 Gene:timm-17B.2 / 183965 WormBaseID:WBGene00017069 Length:140 Species:Caenorhabditis elegans


Alignment Length:148 Identity:44/148 - (29%)
Similarity:75/148 - (50%) Gaps:14/148 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IESVRLRTPAIAGSFAIWGATFSTVDCVMVSYRQREDSWNAIVSGAATGGILAARNGIRAMANSA 115
            :..||:|:......||.||..|||:||.:|:.|::|||.|:||||..||.:||.|        |.
 Worm     1 MREVRMRSTLAGVQFAAWGGLFSTIDCCLVANRKKEDSINSIVSGGLTGALLAIR--------SP 57

  Fly   116 FVGCLVLAMLEGAGAAVATIYASDGGVKAEES--LITVDQ-QMQRPQWETSVADSNLTGAELERV 177
            .:..:.|.::| .|..:..::......||..:  ||.:|. .::....:.::|:|::  .|...|
 Worm    58 KMERIRLEVIE-LGELMGYVHLQKKVPKAHVNSLLILIDTLSIRAIDVKDTLAESDI--EEFNSV 119

  Fly   178 LDECRAYRAHNKMQQPMR 195
            ::|..|....:.:..|.|
 Worm   120 VEEVLAAMRRDCLTMPQR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 30/77 (39%)
timm-17B.2NP_001367715.1 Tim17 <1..>56 CDD:413300 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.660

Return to query results.
Submit another query.