powered by:
Protein Alignment Tim17a2 and timm-23
DIOPT Version :9
Sequence 1: | NP_649524.1 |
Gene: | Tim17a2 / 40632 |
FlyBaseID: | FBgn0037307 |
Length: | 224 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492953.1 |
Gene: | timm-23 / 173041 |
WormBaseID: | WBGene00008857 |
Length: | 242 |
Species: | Caenorhabditis elegans |
Alignment Length: | 130 |
Identity: | 33/130 - (25%) |
Similarity: | 47/130 - (36%) |
Gaps: | 44/130 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 MGTMGGSLFQYLKGFRNAPSG----LRRGLHGGIESVRLRTPAIAGSFAIWGATFSTVDCVMVSY 82
|..|..:..::..||.. ||| :...|..|:.|||
Worm 147 MTRMVNATMKHGSGFAQ-PSGAIVFMYSALEIGLRSVR--------------------------- 183
Fly 83 RQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCLVLAMLEGAGAAVA-TIYASDGGVKAEE 146
.||..|...:||.||.|..:.:|::|.. ||.|| |.|.|.| |:.::|...:..|
Worm 184 --AEDELNGFGAGALTGAIYRSPHGLKASG----VGALV-----GLGIAAAWTLSSTDSRQRLSE 237
Fly 147 146
Worm 238 237
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Tim17a2 | NP_649524.1 |
Tim17 |
2..>129 |
CDD:295283 |
27/110 (25%) |
timm-23 | NP_492953.1 |
Tim17 |
109..226 |
CDD:280604 |
30/117 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5596 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.