DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and timm-23

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_492953.1 Gene:timm-23 / 173041 WormBaseID:WBGene00008857 Length:242 Species:Caenorhabditis elegans


Alignment Length:130 Identity:33/130 - (25%)
Similarity:47/130 - (36%) Gaps:44/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MGTMGGSLFQYLKGFRNAPSG----LRRGLHGGIESVRLRTPAIAGSFAIWGATFSTVDCVMVSY 82
            |..|..:..::..||.. |||    :...|..|:.|||                           
 Worm   147 MTRMVNATMKHGSGFAQ-PSGAIVFMYSALEIGLRSVR--------------------------- 183

  Fly    83 RQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCLVLAMLEGAGAAVA-TIYASDGGVKAEE 146
              .||..|...:||.||.|..:.:|::|..    ||.||     |.|.|.| |:.::|...:..|
 Worm   184 --AEDELNGFGAGALTGAIYRSPHGLKASG----VGALV-----GLGIAAAWTLSSTDSRQRLSE 237

  Fly   147  146
             Worm   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 27/110 (25%)
timm-23NP_492953.1 Tim17 109..226 CDD:280604 30/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.