DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a2 and TIMM17B

DIOPT Version :9

Sequence 1:NP_649524.1 Gene:Tim17a2 / 40632 FlyBaseID:FBgn0037307 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001161419.1 Gene:TIMM17B / 10245 HGNCID:17310 Length:222 Species:Homo sapiens


Alignment Length:178 Identity:74/178 - (41%)
Similarity:94/178 - (52%) Gaps:50/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTMGGSLFQYLKGFRNAP-------------------------- 40
            ||.|:|||.|||:|||.||.||.:||.:||.:|||||||                          
Human     3 EYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVCRLLSEAPLFIYSCSRSVSPTVNVS 67

  Fly    41 ------------------------SGLRRGLHGGIESVRLRTPAIAGSFAIWGATFSTVDCVMVS 81
                                    .|:|..|.|...:||:|.|.|.||||:||..|||:||.:|.
Human    68 SERAESRPTLFMAVSLHMAWCLAHIGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVR 132

  Fly    82 YRQREDSWNAIVSGAATGGILAARNGIRAMANSAFVGCLVLAMLEGAG 129
            .|.:||.||:|.|||.||.:||||:|..||..||.:|.::||::||.|
Human   133 LRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVG 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a2NP_649524.1 Tim17 2..>129 CDD:295283 73/176 (41%)
TIMM17BNP_001161419.1 Tim17 1..221 CDD:295283 74/178 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152392
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.