DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12173 and enoph1

DIOPT Version :9

Sequence 1:NP_649523.1 Gene:CG12173 / 40630 FlyBaseID:FBgn0037305 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001039112.1 Gene:enoph1 / 733933 XenbaseID:XB-GENE-954014 Length:259 Species:Xenopus tropicalis


Alignment Length:246 Identity:108/246 - (43%)
Similarity:156/246 - (63%) Gaps:13/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVLVDIEGTTTSISFVHDVLFPYAKQNVEKFLRDSWEEDDIKRIVQDLQQVPQYADYKALLSG-- 72
            |:|:|||||||.|:||.||||||.|:|::|:|.:.|:|   |...:|:.|:.:.|:..:.|.|  
 Frog    12 VILLDIEGTTTPITFVKDVLFPYVKENIKKYLLEHWQE---KECQEDVTQLQKQAEKDSHLDGFV 73

  Fly    73 P-PTEVDVDLIAGFVRYLIDQ-------DLKVTPMKTLQGLIWAQGYANGELKGHVYEDVPAAFE 129
            | |:.|..:.....::.::|.       |.|.|.:|.|||.:|...|.:|:|||.|||||..:..
 Frog    74 PIPSGVSDNTTEHMIQAVVDNVYWQMSFDRKTTALKQLQGHMWRSAYISGQLKGEVYEDVVPSIR 138

  Fly   130 AWRAAGLQIAVYSSGSVAAQKLIFGHSLAGNLQPYLSAYFDTHVGHKQEQQSYKNIAKQLKEDPK 194
            .||..|:::.:|||||:.||||:||:|:.|:|...|..:|||::|||.|.:||:|||..:...|:
 Frog   139 QWRELGIKLYIYSSGSIDAQKLLFGYSIEGDLLKLLDGHFDTNIGHKVESKSYRNIADNIGCLPE 203

  Fly   195 QILFLTDIPGEAAAARCAGLQAIILKRPGNAALADDQKTGFELIPDFKPLH 245
            .||||||:..||.||..|||...::.|||||||.|:.|:....|..|..:|
 Frog   204 NILFLTDVVKEALAAEKAGLHVAVVVRPGNAALTDEDKSNCCCITSFHQIH 254

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12173NP_649523.1 enolase-ppase 8..244 CDD:273760 107/243 (44%)
HAD_2 11..217 CDD:290155 95/215 (44%)
enoph1NP_001039112.1 HAD_EP 12..232 CDD:319768 97/222 (44%)