DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12173 and Enoph1

DIOPT Version :9

Sequence 1:NP_649523.1 Gene:CG12173 / 40630 FlyBaseID:FBgn0037305 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006535252.1 Gene:Enoph1 / 67870 MGIID:1915120 Length:265 Species:Mus musculus


Alignment Length:253 Identity:97/253 - (38%)
Similarity:141/253 - (55%) Gaps:20/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVLVDIEGTTTSIS--------FVHDVLFPYAKQNVEKFLRDSWEEDDIKRIVQDLQQVPQYADY 66
            |:|:||||......        .|.||||||.|:||:::|:..|||::.:   ||:..:.:.|:.
Mouse    12 VILLDIEGPRQQFPLGLPLCCLLVKDVLFPYIKENVKEYLQTHWEEEECQ---QDVSLLRKQAEE 73

  Fly    67 KALLSGP---PTEVDVDL------IAGFVRYLIDQDLKVTPMKTLQGLIWAQGYANGELKGHVYE 122
            .|.|.|.   |.....||      :...|.:.:..|.|.|.:|.|||.:|...:..|.:|...:.
Mouse    74 DAHLDGAVPIPVASGSDLQQMIQAVVDNVYWQMSHDRKTTALKQLQGHMWKAAFTAGRMKAEFFA 138

  Fly   123 DVPAAFEAWRAAGLQIAVYSSGSVAAQKLIFGHSLAGNLQPYLSAYFDTHVGHKQEQQSYKNIAK 187
            ||..|...||.||:::.:||||||.||||:||||..|::...:..:|||.:|||.:.:||:.||.
Mouse   139 DVVPAVRRWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELIDGHFDTKIGHKVDSESYRKIAD 203

  Fly   188 QLKEDPKQILFLTDIPGEAAAARCAGLQAIILKRPGNAALADDQKTGFELIPDFKPLH 245
            .:......||||||:..||:||..|.:...::.|||||.|.||:||.:.||..|..|:
Mouse   204 SIGCSTNNILFLTDVTVEASAAEEADVHVAVVVRPGNAGLTDDEKTYYNLITSFSELY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12173NP_649523.1 enolase-ppase 8..244 CDD:273760 96/250 (38%)
HAD_2 11..217 CDD:290155 82/222 (37%)
Enoph1XP_006535252.1 HAD_EP 12..239 CDD:319768 84/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849156
Domainoid 1 1.000 163 1.000 Domainoid score I3968
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5790
Inparanoid 1 1.050 192 1.000 Inparanoid score I3856
Isobase 1 0.950 - 0 Normalized mean entropy S1568
OMA 1 1.010 - - QHG62493
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004317
OrthoInspector 1 1.000 - - oto93698
orthoMCL 1 0.900 - - OOG6_104759
Panther 1 1.100 - - LDO PTHR20371
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R398
SonicParanoid 1 1.000 - - X3051
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.880

Return to query results.
Submit another query.