DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12173 and SPAC644.08

DIOPT Version :9

Sequence 1:NP_649523.1 Gene:CG12173 / 40630 FlyBaseID:FBgn0037305 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_593876.1 Gene:SPAC644.08 / 2543661 PomBaseID:SPAC644.08 Length:216 Species:Schizosaccharomyces pombe


Alignment Length:238 Identity:91/238 - (38%)
Similarity:130/238 - (54%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VAKVVLVDIEGTTTSISFVHDVLFPYAKQNVEKFLRDSWEEDDIKRIVQDLQQVPQYADYKALLS 71
            :.|.:|:|||||..|||||.|.|||||....|.::.:::|.|:..|   :|.:.|:    :||::
pombe     1 MVKNLLLDIEGTVGSISFVKDKLFPYAASRYESYVNENYESDENLR---ELGKTPE----EALIN 58

  Fly    72 GPPTEVDVDLIAGFVRYLIDQDLKVTPMKTLQGLIWAQGYANGELKGHVYEDVPAAFEAWRAAGL 136
                          :|.|..:..|....|.:||.||.:||.:.||..|::.||..|.:.....|:
pombe    59 --------------LRKLHAEGSKERSFKMVQGRIWKKGYESNELTSHLFPDVVPAIQRSLQLGM 109

  Fly   137 QIAVYSSGSVAAQKLIFGHSLAGNLQPYLSAYFDTHVGHKQEQQSYKNIAKQLKEDPKQILFLTD 201
            ::.:||||||.||||.|.||.||||..|.|.|:||.:|.|.|..||..|..  ..:|::.|||:|
pombe   110 RVYIYSSGSVPAQKLYFEHSDAGNLLKYFSGYYDTTIGLKTECGSYVKIVG--NSNPREWLFLSD 172

  Fly   202 IPGEAAAARCAGLQAIILKRPGNAALADDQKTGFELIPDFKPL 244
            ...|..|||..||...::.||||..:.|  .:||.:...|:.|
pombe   173 NINELKAARKVGLHTGLVVRPGNDPVVD--TSGFPVYNSFEIL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12173NP_649523.1 enolase-ppase 8..244 CDD:273760 90/235 (38%)
HAD_2 11..217 CDD:290155 81/205 (40%)
SPAC644.08NP_593876.1 Utr4 1..216 CDD:226682 91/238 (38%)
HAD_2 5..190 CDD:290155 81/207 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1367
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1366
OMA 1 1.010 - - QHG62493
OrthoFinder 1 1.000 - - FOG0004317
OrthoInspector 1 1.000 - - oto101319
orthoMCL 1 0.900 - - OOG6_104759
Panther 1 1.100 - - LDO PTHR20371
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R398
SonicParanoid 1 1.000 - - X3051
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.