DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and Tinagl1

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_446034.1 Gene:Tinagl1 / 94174 RGDID:70956 Length:467 Species:Rattus norvegicus


Alignment Length:256 Identity:67/256 - (26%)
Similarity:114/256 - (44%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 GE-LPKEFDWRQK--DAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKT-GELKE-FSEQELLDCDT 451
            || ||..|:..:|  :.:.:..:||:|...||||.........::.: |.:.. .|.|.||.|||
  Rat   199 GEVLPTAFEASEKWPNLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPILSPQNLLSCDT 263

  Fly   452 -TDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKK--------------------------NQC 489
             ....|.||.:|.|:..::..|.:.... ||:..::                          ::|
  Rat   264 HHQKGCRGGRLDGAWWFLRRRGVVSDNC-YPFSGREQNDEASPTPRCMMHSRAMGRGKRQATSRC 327

  Fly   490 HFNRTLSH--VQVAGFVDLPKGNETAMQEWLLANGPIS--IGINANAMQFYRGGVSH-------P 543
            ..::..|:  .||.....|....:..|:| |:.|||:.  :.::.:...:.||..||       |
  Rat   328 PNSQVDSNDIYQVTPVYRLASDEKEIMKE-LMENGPVQALMEVHEDFFLYQRGIYSHTPVSQGRP 391

  Fly   544 WKALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGV 604
            .:   .:::..|.|.:.|:|....|: .:|:.||...|||||.|||:|::|:.||.|.|.:
  Rat   392 EQ---YRRHGTHSVKITGWGEETLPD-GRTIKYWTAANSWGPWWGERGHFRIVRGINECDI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458
Peptidase_C1A 395..611 CDD:239068 64/252 (25%)
Tinagl1NP_446034.1 Somatomedin_B 53..93 CDD:279385
VWC 104..>152 CDD:302663
Peptidase_C1A_CathepsinB 203..455 CDD:239111 64/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.