DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsF and RD21A

DIOPT Version :10

Sequence 1:NP_730901.1 Gene:CtsF / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_564497.1 Gene:RD21A / 841122 AraportID:AT1G47128 Length:462 Species:Arabidopsis thaliana


Alignment Length:210 Identity:49/210 - (23%)
Similarity:78/210 - (37%) Gaps:58/210 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KFQINTQSDTIYVNLNYLAELS--EYFHILRTGFYSEMTAEKVNLNDVFAEDLVVFLSYVCPDGF 79
            |:..:::.:..:|.: ||..|.  ||....|   |.|.. :||:|  :|....||:|.:      
plant   211 KWDESSEPEPCFVTI-YLPNLKILEYCRFER---YDEAN-DKVSL--LFHNPKVVYLEF------ 262

  Fly    80 EFDRTINQHNITPLVYFSD--------RLVFPWVKR--EVHKYLNSEAFQNEIYDTELLVQLCYL 134
             ||...:::.   .|.|..        ||.:..|..  |...|::|:...|.   |.||..:|.:
plant   263 -FDSIADRYQ---QVSFGSLVEARLGIRLTYDQVYNHLETEYYVSSKEKSNV---TNLLTGICNV 320

  Fly   135 LHSQNYSEIDVVFKKIALIDNPLVVDRLVQEITDSDVQSFFTKKILQYRPY-TEKPRPQM----- 193
                         |.:.|.|..|.|....::..  .|.|...:..:|.:|: ..||.|.|     
plant   321 -------------KILYLSDETLEVFGCCRDTI--PVFSNLIELTIQTKPHIIWKPLPAMLNNCP 370

  Fly   194 -----FFDWDHTPYS 203
                 .|:..|..||
plant   371 NLITLIFEGMHHIYS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsFNP_730901.1 Inhibitor_I29 308..365 CDD:462410
Peptidase_C1A 395..611 CDD:239068
RD21ANP_564497.1 Inhibitor_I29 50..107 CDD:214853
Peptidase_C1 137..352 CDD:425470 39/175 (22%)
GRAN 376..432 CDD:197621 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.