DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and AT1G03720

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_171868.1 Gene:AT1G03720 / 839426 AraportID:AT1G03720 Length:274 Species:Arabidopsis thaliana


Alignment Length:286 Identity:64/286 - (22%)
Similarity:107/286 - (37%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 ITEFADMTSSEYKERTGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDA-----VTQVKNQG 413
            :.:|.....:..|.....||..:|          |....|:.:|....:|..     |||..:.|
plant     2 VLDFFSFVGNGEKRAIHWWQTYKA----------PKVPNEIKREAATAKKKGPTITPVTQTDDNG 56

  Fly   414 --------SCGS-----CWAFSVTGNIEGLYAVK----TGELKEFSEQEL---LDCDTTDSACNG 458
                    :|.|     |||.::|..::.:|.:.    .|.|: |...:|   |....|.....|
plant    57 VRSKLCYLNCNSYKIEICWAIALTRLLQVIYNITQEYIAGRLR-FDHDDLVVHLKMKKTRGKRPG 120

  Fly   459 GL-MDNAYKAIKDIG--GLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLA 520
            .: :.|...||..|.  ||..:.|...||..:..|..:....::.....|..|..        :.
plant   121 SMKLKNLKDAINHIAVKGLLKKRESKSKAGSDIGHHTKWNFSMEKCPSKDFIKSK--------VD 177

  Fly   521 NGPISIGINANAMQFYRGGVSHPWKALC--SKKNLD--------HGVLVVGYGVSDYPNFHKTLP 575
            ..|::|..:......:.|.||.....|.  :...:|        |.||:||||   |...:|.  
plant   178 ISPVAIAFDITHNFQFIGNVSKKSNGLSIYNVSGVDMEDGDAGGHVVLIVGYG---YTKENKL-- 237

  Fly   576 YWIVKNSWGPRWGEQGYYRVYRGDNT 601
            :::::||||..||.:|:.|::..|.:
plant   238 FFLIQNSWGEDWGVKGFGRIFIDDES 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 1/10 (10%)
Peptidase_C1A 395..611 CDD:239068 57/245 (23%)
AT1G03720NP_171868.1 Peptidase_C1 57..261 CDD:239110 50/217 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.