DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12163 and XCP2

DIOPT Version :9

Sequence 1:NP_730901.1 Gene:CG12163 / 40628 FlyBaseID:FBgn0260462 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_564126.1 Gene:XCP2 / 838677 AraportID:AT1G20850 Length:356 Species:Arabidopsis thaliana


Alignment Length:328 Identity:135/328 - (41%)
Similarity:193/328 - (58%) Gaps:36/328 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 SHRFDKVDHLFYKFQVRFGRRYVSTAERQMRLRIFRQNLKTIEELNANEMGSAKY-GITEFADMT 361
            ||  ||:..||..:...|.:.|.:..|:.:|..:|:.|||.|:|  .|:.|.:.: |:.||||::
plant    43 SH--DKLIELFENWISNFEKAYETVEEKFLRFEVFKDNLKHIDE--TNKKGKSYWLGLNEFADLS 103

  Fly   362 SSEYKE-----RTGLWQRDEAKATGGSAAVVPAYHG--ELPKEFDWRQKDAVTQVKNQGSCGSCW 419
            ..|:|:     :|.:.:|||.::....     ||..  .:||..|||:|.||.:|||||||||||
plant   104 HEEFKKMYLGLKTDIVRRDEERSYAEF-----AYRDVEAVPKSVDWRKKGAVAEVKNQGSCGSCW 163

  Fly   420 AFSVTGNIEGLYAVKTGELKEFSEQELLDCDTT-DSACNGGLMDNAYKAIKDIGGLEYEAEYPYK 483
            |||....:||:..:.||.|...|||||:||||| ::.|||||||.|::.|...|||..|.:|||.
plant   164 AFSTVAAVEGINKIVTGNLTTLSEQELIDCDTTYNNGCNGGLMDYAFEYIVKNGGLRKEEDYPYS 228

  Fly   484 AKKNQCHFNRTLSH-VQVAGFVDLPKGNETAMQEWLLANGPISIGINANA--MQFYRGGVSHPWK 545
            .::..|...:..|. |.:.|..|:|..:|.::.: .||:.|:|:.|:|:.  .|||.|||   :.
plant   229 MEEGTCEMQKDESETVTINGHQDVPTNDEKSLLK-ALAHQPLSVAIDASGREFQFYSGGV---FD 289

  Fly   546 ALCSKKNLDHGVLVVGYGVSDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRG----DNTCGVSE 606
            ..|. .:|||||..||||.|      |...|.||||||||:|||:||.|:.|.    :..||:::
plant   290 GRCG-VDLDHGVAAVGYGSS------KGSDYIIVKNSWGPKWGEKGYIRLKRNTGKPEGLCGINK 347

  Fly   607 MAT 609
            ||:
plant   348 MAS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12163NP_730901.1 CY 194..272 CDD:298856
Inhibitor_I29 308..365 CDD:285458 18/57 (32%)
Peptidase_C1A 395..611 CDD:239068 104/223 (47%)
XCP2NP_564126.1 Inhibitor_I29 51..106 CDD:214853 18/56 (32%)
Peptidase_C1 138..353 CDD:395062 104/224 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4419
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.